Loading...
Statistics

www.newlexhome.com
www.newlexhome.com/
Advertisement

Newlexhome.com

Newlexhome.com is hosted in United States / San Antonio . Newlexhome.com doesn't use HTTPS protocol. Number of used technologies: 1. First technologies: Html, Number of used javascripts: 0. Number of used analytics tools: 0. Number of used plugins, modules: 0. Its server type is: nginx/1.10.0.

Technologies in use by Newlexhome.com

Technology

Number of occurences: 1
  • Html

Advertisement

Server Type

  • nginx/1.10.0

Conversion rate optimization

visitors Clickable call number Not founded!
visitors Conversion form (contact form, subcriber) Not founded!
visitors Clickable email Not founded!
visitors CTA (call to action) button Not founded!
visitors List Not founded!
visitors Image Not founded!
visitors Enhancement Not founded!
visitors Responsive website Not founded!
visitors Facebook sharing Not founded!
visitors Google+ sharing Not founded!
visitors Twitter sharing Not founded!
visitors Linkedin sharing Not founded!
visitors Blog on the webiste Not founded!

HTTPS (SSL) - Newlexhome.com

Missing HTTPS protocol.

    Meta - Newlexhome.com

    Number of occurences: 0

    Server / Hosting

    • IP: 104.130.124.96
    • Latitude: 29.49
    • Longitude: -98.40
    • Country: United States
    • City: San Antonio

    Rname

    • ns1.mytrafficmanagement.com
    • ns2.mytrafficmanagement.com

    Target

    • admin.newlexhome.com

    HTTP Header Response

    HTTP/1.1 200 OK Server: nginx/1.10.0 Date: Sat, 30 Apr 2016 18:58:31 GMT Content-Type: application/octet-stream Content-Length: 110 Connection: keep-alive Content-Type: text/html

    DNS

    host: newlexhome.com
    1. class: IN
    2. ttl: 300
    3. type: A
    4. ip: 104.130.124.96
    host: newlexhome.com
    1. class: IN
    2. ttl: 300
    3. type: NS
    4. target: ns1.mytrafficmanagement.com
    host: newlexhome.com
    1. class: IN
    2. ttl: 300
    3. type: NS
    4. target: ns2.mytrafficmanagement.com
    host: newlexhome.com
    1. class: IN
    2. ttl: 300
    3. type: SOA
    4. mname: localhost
    5. rname: admin.newlexhome.com
    6. serial: 100
    7. refresh: 10800
    8. retry: 3600
    9. expire: 604800
    10. minimum-ttl: 3600

    Common Typos/Mistakes

    This list shows You some spelling mistakes at internet search for this domain.

    www.ewlexhome.com, www.nnewlexhome.com, www.newlexhome.com, www.nhewlexhome.com, www.hewlexhome.com, www.njewlexhome.com, www.jewlexhome.com, www.nkewlexhome.com, www.kewlexhome.com, www.nlewlexhome.com, www.lewlexhome.com, www.n ewlexhome.com, www. ewlexhome.com, www.nwlexhome.com, www.nexwlexhome.com, www.nxwlexhome.com, www.neswlexhome.com, www.nswlexhome.com, www.newwlexhome.com, www.nwwlexhome.com, www.nerwlexhome.com, www.nrwlexhome.com, www.nefwlexhome.com, www.nfwlexhome.com, www.nevwlexhome.com, www.nvwlexhome.com, www.necwlexhome.com, www.ncwlexhome.com, www.neqwlexhome.com, www.nqwlexhome.com, www.neawlexhome.com, www.nawlexhome.com, www.neywlexhome.com, www.nywlexhome.com, www.nelexhome.com, www.new lexhome.com, www.ne lexhome.com, www.newclexhome.com, www.neclexhome.com, www.newlexhome.com, www.nelexhome.com, www.newdlexhome.com, www.nedlexhome.com, www.newflexhome.com, www.neflexhome.com, www.newglexhome.com, www.neglexhome.com, www.newblexhome.com, www.neblexhome.com, www.newexhome.com, www.newluexhome.com, www.newuexhome.com, www.newl8exhome.com, www.new8exhome.com, www.newl9exhome.com, www.new9exhome.com, www.newljexhome.com, www.newjexhome.com, www.newl0exhome.com, www.new0exhome.com, www.newlmexhome.com, www.newmexhome.com, www.newlpexhome.com, www.newpexhome.com, www.newloexhome.com, www.newoexhome.com, www.newlxhome.com, www.newlexxhome.com, www.newlxxhome.com, www.newlesxhome.com, www.newlsxhome.com, www.newlewxhome.com, www.newlwxhome.com, www.newlerxhome.com, www.newlrxhome.com, www.newlefxhome.com, www.newlfxhome.com, www.newlevxhome.com, www.newlvxhome.com, www.newlecxhome.com, www.newlcxhome.com, www.newleqxhome.com, www.newlqxhome.com, www.newleaxhome.com, www.newlaxhome.com, www.newleyxhome.com, www.newlyxhome.com, www.newlehome.com, www.newlexqhome.com, www.newleqhome.com, www.newlexhome.com, www.newlehome.com, www.newlexahome.com, www.newleahome.com, www.newlexshome.com, www.newleshome.com, www.newlexdhome.com, www.newledhome.com, www.newlexehome.com, www.newleehome.com, www.newlexome.com, www.newlexheome.com, www.newlexeome.com, www.newlexhdome.com, www.newlexdome.com, www.newlexhcome.com, www.newlexcome.com, www.newlexhuome.com, www.newlexuome.com, www.newlexhjome.com, www.newlexjome.com, www.newlexhome.com, www.newlexome.com, www.newlexhbome.com, www.newlexbome.com, www.newlexhgome.com, www.newlexgome.com, www.newlexhme.com, www.newlexhobme.com, www.newlexhbme.com, www.newlexhohme.com, www.newlexhhme.com, www.newlexhogme.com, www.newlexhgme.com, www.newlexhojme.com, www.newlexhjme.com, www.newlexhomme.com, www.newlexhmme.com, www.newlexho me.com, www.newlexh me.com, www.newlexhovme.com, www.newlexhvme.com, www.newlexhoe.com, www.newlexhompe.com, www.newlexhope.com, www.newlexhomoe.com, www.newlexhooe.com, www.newlexhomie.com, www.newlexhoie.com, www.newlexhomke.com, www.newlexhoke.com, www.newlexhom.e.com, www.newlexho.e.com, www.newlexhomue.com, www.newlexhoue.com, www.newlexhomje.com, www.newlexhoje.com, www.newlexhomne.com, www.newlexhone.com, www.newlexhom-e.com, www.newlexho-e.com, www.newlexhom.com, www.newlexhomex.com, www.newlexhomx.com, www.newlexhomes.com, www.newlexhoms.com, www.newlexhomew.com, www.newlexhomw.com, www.newlexhomer.com, www.newlexhomr.com, www.newlexhomef.com, www.newlexhomf.com, www.newlexhomev.com, www.newlexhomv.com, www.newlexhomec.com, www.newlexhomc.com, www.newlexhomeq.com, www.newlexhomq.com, www.newlexhomea.com, www.newlexhoma.com, www.newlexhomey.com, www.newlexhomy.com,

    Other Reviews

    1. c-cbs.co.uk
      United Kingdom - 85.233.160.22
      Server software: Apache
      Technology: Html, Javascript, Php
      Number of meta tags: 1
    2. GTA-Universe.ru - Новости, моды, статьи GTA
      Новости Grand Theft Auto, Rockstar. Сборник лучших мировых модификаций и всегда обширная и пополняемая информация о GTA.
      Moscow (Russian Federation) - 193.109.246.55
      G Analytics ID: UA-45896238-1
      Server software: nginx/1.8.0
      Technology: Google Adsense, CSS, Google Font API, Html, Javascript, Yandex.Metrika, Google Analytics, LiveInternet counter
      Number of Javascript: 8
      Number of meta tags: 2
    3. موقع الحلول التكنولوجية
      Columbus (United States) - 98.130.42.2
      Server software:
      Technology: CSS, Html, Javascript, Google Analytics
      Number of Javascript: 3
      Number of meta tags: 1
    4. MykonosButler.Com
      Denver (United States) - 108.174.149.9
      G Analytics ID: UA-64124776-1
      Server software: Apache
      Technology: CSS, Flexslider, Font Awesome, Google Font API, Html, Html5, Javascript, jQuery, jQuery Fancybox, Php, Pingback, SuperFish, Google Analytics, Wordpress
      Number of Javascript: 21
      Number of meta tags: 3
    5. Home Page
      Home Page
      Scottsdale (United States) - 97.74.210.129
      Server software: Apache
      Technology: CSS, Html
      Number of meta tags: 4
    6. bjsywh.com
      Éý¿ÕÆøÇò,ÆøÇòӡ×Ö,À²À²°ô,³äÆø°ô--ʢԪÐ˴ïÎĻ¯Çìµ䴫ҥÓÐÏ޹«˾.רҵ´ÓÊÂÉý¿ÕÆøÇò,ÆøÇòӡ×Ö,À²À²°ô,³äÆø°ôµÄÉú²úºÍÏúÊۡ£Èç¹ûÄúÐèҪÉý¿ÕÆøÇò,ÆøÇòӡ×Ö,À²À²°ô,³äÆø°ô£¬ÇëÁªϵÎÒÃǡ£010-52383269
      Beijing (China) - 180.86.155.88
      Server software: Microsoft-IIS/6.0
      Technology: CSS, Iframe, Swf Object
      Number of Javascript: 1
      Number of meta tags: 3
    7. Songs of Power and Prayer in the Columbia Plateau | The Jesuit, the Medicine Man, and the Indian Hymn Singer
      Corvallis (United States) - 128.193.164.143
      Server software: Apache/2.2.15 (CentOS)
      Technology: CSS, Html, Html5, Javascript, jQuery, Php, Pingback, Wordpress
      Number of Javascript: 9
      Number of meta tags: 3
    8. MICHIGANSPEEDINGTICKETLAWYER.COM | MICHIGANSPEEDINGTICKETLAWYER.COM
      Scottsdale (United States) - 166.62.28.82
      Server software: Apache/2.4.12
      Technology: CSS, Html, Html5, Javascript, jQuery, Php, Pingback, Wordpress
      Number of Javascript: 4
      Number of meta tags: 3
    9. ~~ Villa Spessartruh Weibersbrunn ~~ Gasthof ~ Pension ~ Biergarten ~~
      Gastronomie,Ãœbernachtung,Verpflegung
      Germany - 217.160.233.205
      Server software: Apache
      Technology: Html
      Number of meta tags: 12